<code id='4A3D98096C'></code><style id='4A3D98096C'></style>
    • <acronym id='4A3D98096C'></acronym>
      <center id='4A3D98096C'><center id='4A3D98096C'><tfoot id='4A3D98096C'></tfoot></center><abbr id='4A3D98096C'><dir id='4A3D98096C'><tfoot id='4A3D98096C'></tfoot><noframes id='4A3D98096C'>

    • <optgroup id='4A3D98096C'><strike id='4A3D98096C'><sup id='4A3D98096C'></sup></strike><code id='4A3D98096C'></code></optgroup>
        1. <b id='4A3D98096C'><label id='4A3D98096C'><select id='4A3D98096C'><dt id='4A3D98096C'><span id='4A3D98096C'></span></dt></select></label></b><u id='4A3D98096C'></u>
          <i id='4A3D98096C'><strike id='4A3D98096C'><tt id='4A3D98096C'><pre id='4A3D98096C'></pre></tt></strike></i>

          comprehensive

          comprehensive

          author:Wikipedia    Page View:6821
          Close up of a cow being milked by machine for story about bird flu spreading to dairy workers in the U.S.
          BRENDAN SMIALOWSKI/AFP via Getty Images

          A third human case of H5 bird flu tied to the ongoing U.S. outbreak in cattle has been detected in a farmworker in Michigan, state health authorities confirmed on Thursday.

          The unnamed individual worked on a dairy farm and was in close contact with infected cows, the state health department said in a statement. The farm involved is different from the one where an earlier human case was detected last week.

          advertisement

          “With this case, respiratory symptoms occurred after direct exposure to an infected cow,” Natasha Bagdasarian, chief medical executive of the Michigan Department of Health and Human Services, said in a statement. The individual was not wearing protective equipment, she said.

          In a separate statement, the Centers for Disease Control and Prevention said the individual had a cough without a fever and “eye discomfort” with watery discharge.

          H5N1 bird flu: Go deeper

          • The federal responseto bird flu spreading among dairy cattle could be hampered by USDA-FDA turf wars.
          • Scientists with 30 yearsof experience in avian flu are watching the latest outbreak developments with vigilance and dread.
          • The CDC launcheda bird flu wastewater surveillance dashboard to warn localities of possible outbreaks.
          • Many dairy farmerswere reluctant to embrace H5N1 control measures, so the federal government started offering incentives for bird flu protective measures.

          The significance of respiratory symptoms relates to the possibility of onward spread. In people, influenza transmits via the respiratory route. A person with flu virus in their airways could be more likely to spread the virus — if the virus has the capacity to transmit between humans — than a person with an infection in their eye. To date, H5 viruses have not been seen to spread easily among people, and Michigan and federal officials said the risk to the general public remains low.

          advertisement

          “What the presence of respiratory symptoms tells us is that the exposure risk is higher,” CDC Deputy Director Nirav Shah said at a news conference Thursday. “Simply put, someone who’s coughing may be more likely to transmit the virus than someone who has an eye infection like conjunctivitis.”

          The worker was given flu antiviral drugs and is recovering. “The individual was not hospitalized. We would characterize this as a mild illness,” Bagdasarian said in an interview with STAT.

          She said the farmworker was caring for sick cows and had a significant amount of exposure to the animals. Likewise, the previous Michigan case had had milk from an infected cow splash into his eye. “This is not walking past an infected animal. This is not a very transient or limited exposure,” Bagdasarian said.

          The CDC said the individual was instructed to isolate, and household contacts were also offered antiviral drugs. Asked whether the contacts agreed to take the drugs, Bagdasarian sidestepped the question, noting that people have the right to choose whether or not they wish to comply.

          “In general, all of this is voluntary. We don’t have any requirements that folks either must wear PPE in certain situations, that they must undergo testing, that they must receive Tamiflu,” she said, stressing that achieving compliance requires creating a rapport between public health workers and the individuals with whom they are interacting. She noted that over the course of Michigan’s response to the H5N1 situation, several people have refused to be tested and several have refused the offer of antiviral drugs.

          Related: New evidence supports fear that drinking raw milk containing bird flu viruses may be dangerous

          To date, there is no evidence of other infections from the farm where the individual was infected.

          “No other workers at the same farm have reported symptoms, and all staff are being monitored. There is no indication of person-to-person spread of A(H5N1) viruses at this time,” the CDC said in its statement.

          At least 40 people have been tested for the virus, and roughly 350 workers are being monitored, many of them in Michigan, Shah said. “We would like to be doing more testing,” he added.

          Also on Thursday, the Agriculture Department announced it will put an additional $824 million toward broader testing and surveillance for the bird flu on dairy farms, and it is launching a voluntary pilot program for farms to consistently test milk. If herds show no sign of H5N1 for three weeks, farmers participating in the pilot can freely move the cattle without having to test them.

          Federal officials also said that while states are supplying personal protective equipment to farmworkers, uptake has been “mixed.” A spokesperson for the Department of Health and Human Services told STAT last week that five states had requested gear, primarily goggles, from the national stockpile.

          State public health officials “have been trying to make PPE more available, but there’s just not demand for it,” said Marcus Plescia, chief medical officer of the Association of State and Territorial Health Officials. The low uptake will likely persist as temperatures rise in the summer, he and federal health officials said.

          Of the four known cases of H5 infection that have been reported in the United States — three since the outbreak in cattle began — this is the first in which an infected individual reported respiratory symptoms. The two human cases reported earlier this year experienced only conjunctivitis — known as pink eye. Those cases occurred in Texas and in Michigan, and were both in farmworkers who had contact with infected cows.

          The first U.S. case of H5N1 occurred in April 2022 and involved a man in Colorado who was involved in culling chickens on a poultry farm where the virus had broken out; though he tested positive for the virus, he reported only feeling fatigue.

          The Michigan statement described the virus in the new case solely as an H5 virus. The CDC, which does confirmatory testing for H5N1 cases, said it is attempting to generate a full genetic sequence of the virus and if the efforts are successful, it will release further information in a day or two.

          Related: Wastewater testing specifically for bird flu virus will scale up nationally in coming weeks

          Prior to this outbreak, it was not believed that cattle could be infected with this virus — an assumption that probably contributed to the slow realization that a mystery illness that was affecting milk production in some dairy herds located in the Texas panhandle starting in February was actually avian influenza.

          Since the late March announcement that H5N1 was the reason for the drop in milk production, the USDA has confirmed 69 infected livestock herds in nine states. One of the herds was alpacas, the rest have been dairy cattle.

          Infectious disease experts suspect the outbreak is more widespread than the number of confirmed states would suggest, a belief that is supported by a survey of commercially purchased milk conducted by the Food and Drug Administration. Of nearly 300 pasteurized milk products bought in 38 states, 1 in 5 were positive by polymerase chain reaction testing for the H5N1 virus. Efforts to grow viable virus from milk that tested positive failed, supporting the FDA’s position that pasteurization kills the virus.

          There are concerns, though, that unpasteurized milk — generally referred to as raw milk — could subject consumers to dangerous levels of the virus, if the herd that produced the milk was infected with H5N1.

          A study published last week in the New England Journal of Medicine reported that mice fed raw milk known to have come from infected cows made the mice sick enough that they had to be euthanized. There have been multiple reports of deaths of cats on farms with infected herds, and one of the infected alpacas displayed neurological symptoms before it died, Sydney Kennedy, a public information officer for the Idaho State Department of Agriculture, told STAT in an email.

          While the virus is deadly in poultry, and has been seen to kill multiple mammal species — from polar bears to foxes, from zoo tigers to sea lions — it does not, in general, seriously sicken cows. As a result, there’s been little upside for farmers to agree to have their animals tested. While the case count continues to grow in most of the states with confirmed herds, there has not been a new state to acknowledge having infected animals since Colorado joined the list on April 25.

          A federal order that went into effect on April 29 requires farmers to test some of the lactating cows they plan to transport over state lines, though they are required to test a maximum of 30 animals per shipment, and the farmer can choose which animals are tested.

          The USDA announced Wednesday that nearly 2,500 pre-movement tests have been conducted. It did not say how many of those tests produced positive results, and the agency has not acknowledged or responded to a STAT request for that figure.

          Sarah Owermohle and Rachel Cohrs Zhang contributed reporting.

          comprehensive

          Apple is now the first public company to be valued at $3 trillion
          Apple is now the first public company to be valued at $3 trillion

          6:09FILE-AnApplelogoadornsthefacadeofthedowntownBrooklynApplestoreonMarch14,2020,inNewYork.Applebeca

          read more
          Here's how to stay safe from wildfire smoke amid reduced air quality
          Here's how to stay safe from wildfire smoke amid reduced air quality

          1:54ApersonwearingafacemaskwalksnearaviewofthetheEmpireStateBuildingduringheavysmoginNewYorkonJune6,

          read more
          Peter Hotez and the public health issue of online harassment
          Peter Hotez and the public health issue of online harassment

          AdobeFather’sDayweekendwasanythingbutcalmonTwitter,whicheruptedasvaccineexpertPeterHotezwaschallenge

          read more

          UnitedHealth wins $3.3 billion takeover of Amedisys

          UnitedHealthGroup’sOptumwillpay$3.3billiontotalforthehomehealthgiantAmedisys.JimMone/APHomehealthand