<code id='F001AF1E74'></code><style id='F001AF1E74'></style>
    • <acronym id='F001AF1E74'></acronym>
      <center id='F001AF1E74'><center id='F001AF1E74'><tfoot id='F001AF1E74'></tfoot></center><abbr id='F001AF1E74'><dir id='F001AF1E74'><tfoot id='F001AF1E74'></tfoot><noframes id='F001AF1E74'>

    • <optgroup id='F001AF1E74'><strike id='F001AF1E74'><sup id='F001AF1E74'></sup></strike><code id='F001AF1E74'></code></optgroup>
        1. <b id='F001AF1E74'><label id='F001AF1E74'><select id='F001AF1E74'><dt id='F001AF1E74'><span id='F001AF1E74'></span></dt></select></label></b><u id='F001AF1E74'></u>
          <i id='F001AF1E74'><strike id='F001AF1E74'><tt id='F001AF1E74'><pre id='F001AF1E74'></pre></tt></strike></i>

          hotspot

          hotspot

          author:comprehensive    Page View:9
          Eli Lilly headquarters in Indianapolis – pharmaceutical coverage from STAT
          Darron Cummings/AP

          The Food and Drug Administration on Thursday approved an Eli Lilly drug that takes a new approach to treating ulcerative colitis, a chronic inflammatory disease that can cause intense gastrointestinal pain and distress.

          The therapy, dubbed Omvoh, is an antibody that blocks IL-23p19, an immune signaling molecule that plays a key role in sustaining the disease. It’s the first treatment to target this particular pathway in ulcerative colitis. The drug’s approval comes after two late-stage trials found that patients taking Omvoh showed a significant improvement in symptoms after both three months and a year compared with those given a placebo, and that the therapy had minimal side effects.

          advertisement

          Omvoh’s list price will be $9,593 per month for intravenous delivery and $10,360 per dose injected beneath the skin. A company spokesperson told STAT that patients who have the drug covered by commercial insurance may pay as little as $5 per month for up to 30 months.

          Get unlimited access to award-winning journalism and exclusive events.

          Subscribe Log In

          explore

          Cancer drug shortages should be causing more outrage
          Cancer drug shortages should be causing more outrage

          DrugshortagesareagrowingproblemintheU.S.,andashortageoflivesavingcancerdrugsinparticularhasreachedcr

          read more
          How generative AI ratchets up security threats for health systems
          How generative AI ratchets up security threats for health systems

          AdobeTheubiquityofAItoolslikeChatGPTcouldbeaboontohospitalseagerfordiagnosticaidsoradministrativeass

          read more
          Trump demands the U.S. pay no more for drugs than other countries … again
          Trump demands the U.S. pay no more for drugs than other countries … again

          EthanMiller/GettyImagesWASHINGTON—FormerPresidentTrumpisbacktocampaigningfortyingMedicaredrugpricest

          read more

          Telehealth options flood the market as retailers push virtual care

          AdobeWhenpatientsgoshoppingtoday,theymightfindthemselvescheckingoutwithmorethanthevitaminsorbulktoil