<code id='9D43878752'></code><style id='9D43878752'></style>
    • <acronym id='9D43878752'></acronym>
      <center id='9D43878752'><center id='9D43878752'><tfoot id='9D43878752'></tfoot></center><abbr id='9D43878752'><dir id='9D43878752'><tfoot id='9D43878752'></tfoot><noframes id='9D43878752'>

    • <optgroup id='9D43878752'><strike id='9D43878752'><sup id='9D43878752'></sup></strike><code id='9D43878752'></code></optgroup>
        1. <b id='9D43878752'><label id='9D43878752'><select id='9D43878752'><dt id='9D43878752'><span id='9D43878752'></span></dt></select></label></b><u id='9D43878752'></u>
          <i id='9D43878752'><strike id='9D43878752'><tt id='9D43878752'><pre id='9D43878752'></pre></tt></strike></i>

          hotspot

          hotspot

          author:fashion    Page View:99
          Cambridge: AbbVie
          Ruby Wallau for STAT

          AbbVie will pay $10 billion for the biotech firm Immunogen, the company said Thursday, acquiring an approved treatment for ovarian cancer and buying into a burgeoning area of oncology.

          Under the agreement, AbbVie will pay $31.26 per share in cash for Immunogen, a nearly 100% premium to the company’s recent trading price. Central to the deal, expected to close in the middle of next year, is Elahere, an Immunogen product that won Food and Drug Administration approval for advanced ovarian cancer in 2022.

          advertisement

          Elahere is among a surging class of cancer medicines called antibody-drug conjugates, or ADCs, which are designed to deliver a targeted dose of chemotherapy directly to tumor cells while sparing healthy tissues. AbbVie’s acquisition is the latest multibillion-dollar deal in the space, following Merck’s $22 billion agreement with ADC specialist Daiichi Sankyo and Pfizer’s $43 billion buyout of Seagen earlier this year.

          Get unlimited access to award-winning journalism and exclusive events.

          Subscribe Log In

          knowledge

          Psychedelics group wrestles with new pharma identity
          Psychedelics group wrestles with new pharma identity

          OliviaGoldhill/STATDENVER—Hecouldhavebeenarockstar,areligiousicon,thewayecstaticapplausefromthousand

          read more
          STAT Wunderkinds: Ruey Hu's digital tools for parsing research
          STAT Wunderkinds: Ruey Hu's digital tools for parsing research

          HugraduatingfromJohnsHopkinsandbeinginductedintotheDeltaOmegaPublicHealthHonorSocietyin2017.Courtesy

          read more
          Jerome Adams on the need for new antivirals for Covid
          Jerome Adams on the need for new antivirals for Covid

          PaxlovidtabletsamplesbeinginspectedinFreiburg,Germany.PfizerviaAPTheU.S.Covid-19Public HealthEmergen

          read more

          Telehealth options flood the market as retailers push virtual care

          AdobeWhenpatientsgoshoppingtoday,theymightfindthemselvescheckingoutwithmorethanthevitaminsorbulktoil