<code id='992BD72C12'></code><style id='992BD72C12'></style>
    • <acronym id='992BD72C12'></acronym>
      <center id='992BD72C12'><center id='992BD72C12'><tfoot id='992BD72C12'></tfoot></center><abbr id='992BD72C12'><dir id='992BD72C12'><tfoot id='992BD72C12'></tfoot><noframes id='992BD72C12'>

    • <optgroup id='992BD72C12'><strike id='992BD72C12'><sup id='992BD72C12'></sup></strike><code id='992BD72C12'></code></optgroup>
        1. <b id='992BD72C12'><label id='992BD72C12'><select id='992BD72C12'><dt id='992BD72C12'><span id='992BD72C12'></span></dt></select></label></b><u id='992BD72C12'></u>
          <i id='992BD72C12'><strike id='992BD72C12'><tt id='992BD72C12'><pre id='992BD72C12'></pre></tt></strike></i>

          leisure time

          leisure time

          author:knowledge    Page View:71
          IQVIA signage. -- health tech coverage from STAT
          Adobe

          The health data giant IQVIA became a dominant force by gobbling up its rivals. Over decades, it feasted on upstarts with new datasets or novel technologies, growing into a juggernaut with no peer in the business of brokering Americans’ medical information.

          Now, government regulators say, IQVIA’s appetite for acquisition is getting out of control — and must be reined in.

          advertisement

          A Federal Trade Commission lawsuit seeking to block its acquisition of the digital advertising firm DeepIntent marks a crossroads for the company and the multi-billion dollar medical advertising economy it serves. The agency, which is seeking an injunction and temporary restraining order in federal court, argues that IQVIA’s data vault has become so large — and revealing — that it forms the substrate of an entire industry focused on showering doctors and patients with marketing messages.

          Unlock this article by subscribing to STAT+ and enjoy your first 30 days free!

          GET STARTED Log In

          knowledge

          At least 13 dead in Texas as scorching temps continue
          At least 13 dead in Texas as scorching temps continue

          1:17FirefighterEMTWilliamDorseyandfirefighterEMTRodrigoPinedatreatamigrantwomansufferingfromheatexha

          read more
          What it's like to live with paralysis for one psychologist
          What it's like to live with paralysis for one psychologist

          Photoillustration:CaseySheneryforSTATNikkiSaltzburgwasbornthreemonthsprematurewhileherparentswerevac

          read more
          Over 800 arrested across France in 3rd night of riots after fatal police shooting of teen
          Over 800 arrested across France in 3rd night of riots after fatal police shooting of teen

          1:19Ademonstratorrunsonthethirdnightofprotestssparkedbythefatalpoliceshootingofa17-year-olddriverint

          read more

          In areas with more Black doctors, Black people live longer

          AdobeBlackpeopleincountieswithmoreBlackprimarycarephysicianslivelonger,accordingtoanewnationalanalys