<code id='C49D588B41'></code><style id='C49D588B41'></style>
    • <acronym id='C49D588B41'></acronym>
      <center id='C49D588B41'><center id='C49D588B41'><tfoot id='C49D588B41'></tfoot></center><abbr id='C49D588B41'><dir id='C49D588B41'><tfoot id='C49D588B41'></tfoot><noframes id='C49D588B41'>

    • <optgroup id='C49D588B41'><strike id='C49D588B41'><sup id='C49D588B41'></sup></strike><code id='C49D588B41'></code></optgroup>
        1. <b id='C49D588B41'><label id='C49D588B41'><select id='C49D588B41'><dt id='C49D588B41'><span id='C49D588B41'></span></dt></select></label></b><u id='C49D588B41'></u>
          <i id='C49D588B41'><strike id='C49D588B41'><tt id='C49D588B41'><pre id='C49D588B41'></pre></tt></strike></i>

          focus

          focus

          author:hotspot    Page View:3816
          Influenza A virions
          F. A. Murphy/CDC

          Vir Biotechnology said Thursday that a long-acting antibody drug designed to protect healthy individuals from influenza A failed to do so in a nearly 3,000-person clinical trial.

          Volunteers who received the highest dose of the drug, known as VIR-2482, were only 16% less likely than the placebo group to develop symptomatic influenza A infections, as defined by trial criteria, over a seven-month period. The difference was not statistically significant.

          advertisement

          The results are a setback in broader efforts to develop better protective measures against both seasonal and potential pandemic influenza strains. In the short term, Vir and outside experts hoped VIR-2482 could provide additional annual protection for at-risk groups like older adults, as flu vaccines are often only modestly effective.

          Unlock this article by subscribing to STAT+ and enjoy your first 30 days free!

          GET STARTED Log In

          explore

          Psychedelics group wrestles with new pharma identity
          Psychedelics group wrestles with new pharma identity

          OliviaGoldhill/STATDENVER—Hecouldhavebeenarockstar,areligiousicon,thewayecstaticapplausefromthousand

          read more
          Telehealth options flood the market as retailers push virtual care
          Telehealth options flood the market as retailers push virtual care

          AdobeWhenpatientsgoshoppingtoday,theymightfindthemselvescheckingoutwithmorethanthevitaminsorbulktoil

          read more
          Anesthesiologist group: stop taking Ozempic before surgery
          Anesthesiologist group: stop taking Ozempic before surgery

          EspeciallyinthefirstweeksoftakingdrugslikeOzempic,foodstayslongerinthestomach—aprobleminsurgeries.Ad

          read more

          The pink breast cancer awareness ribbon needs a redesign

          LAURIEDIEFFEMBACQ/BELGAMAG/AFPviaGettyImagesEveryoneknowstheuniversalsymbolofbreastcancer:thepinkrib