<code id='E93A1E7FC3'></code><style id='E93A1E7FC3'></style>
    • <acronym id='E93A1E7FC3'></acronym>
      <center id='E93A1E7FC3'><center id='E93A1E7FC3'><tfoot id='E93A1E7FC3'></tfoot></center><abbr id='E93A1E7FC3'><dir id='E93A1E7FC3'><tfoot id='E93A1E7FC3'></tfoot><noframes id='E93A1E7FC3'>

    • <optgroup id='E93A1E7FC3'><strike id='E93A1E7FC3'><sup id='E93A1E7FC3'></sup></strike><code id='E93A1E7FC3'></code></optgroup>
        1. <b id='E93A1E7FC3'><label id='E93A1E7FC3'><select id='E93A1E7FC3'><dt id='E93A1E7FC3'><span id='E93A1E7FC3'></span></dt></select></label></b><u id='E93A1E7FC3'></u>
          <i id='E93A1E7FC3'><strike id='E93A1E7FC3'><tt id='E93A1E7FC3'><pre id='E93A1E7FC3'></pre></tt></strike></i>

          Wikipedia

          Wikipedia

          author:focus    Page View:8
          3d heart myocarditis
          Adobe

          A drug developed by the biotech firm BridgeBio to treat an increasingly common heart condition succeeded in its main goal in a clinical trial, the company said Monday, and also pointed to potential reductions in hospitalization and death.

          The results may give the medicine, acoramidis, a path to the market after a failure that led its maker’s stock to plunge in December 2021.

          advertisement

          In the time since the initial failure, a rival Pfizer drug has become even more entrenched and another medicine, from Alnylam Pharmaceuticals, has had a successful clinical readout in the heart disease, known as ATTR-CM, in which a defective protein leads clumps to build up in the heart.

          Unlock this article by subscribing to STAT+ and enjoy your first 30 days free!

          GET STARTED Log In

          explore

          In Memoriam: Notable people who died in 2023
          In Memoriam: Notable people who died in 2023

          1:29AlanArkinattendsthe26thAnnualScreenActorsGuildAwardsatTheShrineAuditoriumonJan.19,2020inLosAngel

          read more
          WHO may add ‘noma' to its list of neglected tropical diseases
          WHO may add ‘noma' to its list of neglected tropical diseases

          AchildwithnomasitsonabedinahealthcenterinZinder,Niger.ISSOUFSANOGO/AFPviaGettyImagesIt’sadiseaseofch

          read more
          Bright Health sells Medicare Advantage business to Molina
          Bright Health sells Medicare Advantage business to Molina

          BrightHealthisofficiallyleavingthehealthinsurancemarket.ThecompanyhasagreedtosellitsMedicareAdvantag

          read more

          Telehealth options flood the market as retailers push virtual care

          AdobeWhenpatientsgoshoppingtoday,theymightfindthemselvescheckingoutwithmorethanthevitaminsorbulktoil