<code id='104132F82E'></code><style id='104132F82E'></style>
    • <acronym id='104132F82E'></acronym>
      <center id='104132F82E'><center id='104132F82E'><tfoot id='104132F82E'></tfoot></center><abbr id='104132F82E'><dir id='104132F82E'><tfoot id='104132F82E'></tfoot><noframes id='104132F82E'>

    • <optgroup id='104132F82E'><strike id='104132F82E'><sup id='104132F82E'></sup></strike><code id='104132F82E'></code></optgroup>
        1. <b id='104132F82E'><label id='104132F82E'><select id='104132F82E'><dt id='104132F82E'><span id='104132F82E'></span></dt></select></label></b><u id='104132F82E'></u>
          <i id='104132F82E'><strike id='104132F82E'><tt id='104132F82E'><pre id='104132F82E'></pre></tt></strike></i>

          leisure time

          leisure time

          author:Wikipedia    Page View:396
          Adam's take main illustration
          Molly Ferguson/STAT

          For two days starting on Sunday, Moonlake Immunotherapeutics happily crunched numbers and shared results from a mid-stage clinical trial that depicted its experimental antibody in the most flattering terms possible.

          The drug, called sonelokimab, was “changing the game” for the treatment of a debilitating skin condition called hidradenitis suppurativa, or HS, said Moonlake CEO Jorge Santos da Silva, on a call for investors and analysts. The drug’s benefit for patients placed it “at the top of the heap,” he added.

          advertisement

          For other, equally important data from the same study that did not fit Moonlake’s home-run narrative, the company took a DIY approach. Curious about how sonelokimab performed against a treatment that’s already approved for HS? Pull out a calculator and do the math yourself. How badly did a higher dose of the drug underperform a lower dose? Take a guess.

          Unlock this article by subscribing to STAT+ and enjoy your first 30 days free!

          GET STARTED Log In

          explore

          Novavax promises a turnaround & Lilly roils the obesity market
          Novavax promises a turnaround & Lilly roils the obesity market

          SammyKimballforSTATCanNovavaxfinallygetitright?What’sa“triple-G”drug?AndisNovoNordisklosingground?We

          read more
          Here's how to stay safe from wildfire smoke amid reduced air quality
          Here's how to stay safe from wildfire smoke amid reduced air quality

          1:54ApersonwearingafacemaskwalksnearaviewofthetheEmpireStateBuildingduringheavysmoginNewYorkonJune6,

          read more
          Drug repurposing or repositioning? The language matters
          Drug repurposing or repositioning? The language matters

          AdobeFindinganewmedicineisnevereasy.Butdevelopingtreatmentsforpatientswithrarediseases—conditionstha

          read more

          Correcting Robert F. Kennedy Jr.'s vaccine 'facts'

          JustinSullivan/GettyImagesWhenpeoplemisrepresentfactsontherecord,journalistsareinatoughspot—especial