<code id='F76E2393A1'></code><style id='F76E2393A1'></style>
    • <acronym id='F76E2393A1'></acronym>
      <center id='F76E2393A1'><center id='F76E2393A1'><tfoot id='F76E2393A1'></tfoot></center><abbr id='F76E2393A1'><dir id='F76E2393A1'><tfoot id='F76E2393A1'></tfoot><noframes id='F76E2393A1'>

    • <optgroup id='F76E2393A1'><strike id='F76E2393A1'><sup id='F76E2393A1'></sup></strike><code id='F76E2393A1'></code></optgroup>
        1. <b id='F76E2393A1'><label id='F76E2393A1'><select id='F76E2393A1'><dt id='F76E2393A1'><span id='F76E2393A1'></span></dt></select></label></b><u id='F76E2393A1'></u>
          <i id='F76E2393A1'><strike id='F76E2393A1'><tt id='F76E2393A1'><pre id='F76E2393A1'></pre></tt></strike></i>

          hotspot

          hotspot

          author:entertainment    Page View:42697
          Benjamins
          Adobe

          Biotech startup Generate Biomedicines, which uses artificial intelligence to find new drugs, raised $273 million in a Series C funding round from investors including pharma company Amgen and the VC arm of AI giant NVIDIA.

          Generate was founded in 2018 by venture-creation firm Flagship Pioneering to use machine learning algorithms to identify antibodies, peptides, cell therapies, and other medicines. It launched its first clinical trial in July for a Covid monoclonal antibody, and is working on starting another clinical trial for an asthma treatment.

          advertisement

          The biotech, which is based in Somerville, Mass., has big plans for the next couple of years: It has another 15 drug candidates in the works and plans to introduce 10 more annually, CEO Mike Nally told STAT.

          Get unlimited access to award-winning journalism and exclusive events.

          Subscribe Log In

          explore

          After affirmative action ruling, medical educators look to 'holistic review'
          After affirmative action ruling, medical educators look to 'holistic review'

          AnnaMoneymaker/GettyImagesAfterhavingadaytoreadthroughtheSupremeCourt’sdecisiononaffirmativeaction,s

          read more
          Peter Marks talks Operation Warp Speed for Rare Diseases
          Peter Marks talks Operation Warp Speed for Rare Diseases

          PeterMarks,DirectoroftheCenterforBiologicsEvaluationandResearchattheFoodandDrugAdministration.SusanW

          read more
          Moonlake's readout produced a cash windfall. Risks remain
          Moonlake's readout produced a cash windfall. Risks remain

          MollyFerguson/STATFortwodaysstartingonSunday,MoonlakeImmunotherapeuticshappilycrunchednumbersandshar

          read more

          Telehealth options flood the market as retailers push virtual care

          AdobeWhenpatientsgoshoppingtoday,theymightfindthemselvescheckingoutwithmorethanthevitaminsorbulktoil