<code id='D74DDB53BA'></code><style id='D74DDB53BA'></style>
    • <acronym id='D74DDB53BA'></acronym>
      <center id='D74DDB53BA'><center id='D74DDB53BA'><tfoot id='D74DDB53BA'></tfoot></center><abbr id='D74DDB53BA'><dir id='D74DDB53BA'><tfoot id='D74DDB53BA'></tfoot><noframes id='D74DDB53BA'>

    • <optgroup id='D74DDB53BA'><strike id='D74DDB53BA'><sup id='D74DDB53BA'></sup></strike><code id='D74DDB53BA'></code></optgroup>
        1. <b id='D74DDB53BA'><label id='D74DDB53BA'><select id='D74DDB53BA'><dt id='D74DDB53BA'><span id='D74DDB53BA'></span></dt></select></label></b><u id='D74DDB53BA'></u>
          <i id='D74DDB53BA'><strike id='D74DDB53BA'><tt id='D74DDB53BA'><pre id='D74DDB53BA'></pre></tt></strike></i>

          hotspot

          hotspot

          author:leisure time    Page View:7872
          A person holds an Ozempic pen. -- health coverage from STAT
          Especially in the first weeks of taking drugs like Ozempic, food stays longer in the stomach — a problem in surgeries. Adobe

          Patients fast before surgery to prevent food from getting into their lungs while they’re under — a serious concern that can lead to lung infection. But for those taking a class of treatments that include the widely popular Ozempic and Wegovy, fasting may not be enough to ensure an empty stomach.

          The American Society of Anesthesiologists issued guidance Thursday recommending that patients stop taking this class of treatments, called GLP-1 drugs, before undergoing surgery.

          advertisement

          Though there is limited data on how these drugs affect people having surgery, there are concerns — based on anecdotal reports — that delayed stomach emptying caused by these drugs could increase the risk of regurgitation and food aspiration into lungs when patients are on anesthesia, the group said.

          GLP-1 drugs for type 2 diabetes and obesity have exploded in popularity for their ability to significantly cut people’s weight. They mimic the effects of the glucagon-like peptide 1 hormone that help people feel full after eating. The class of treatments, which include Novo Nordisk’s Ozempic and Wegovy and Eli LIlly’s Mounjaro, have gastrointestinal side effects like nausea, vomiting and delayed stomach emptying.

          Michael Champeau, president of the anesthesiologist group, said they’ve heard anecdotes such as doctors performing endoscopies in patients taking these drugs and seeing food in the stomach, patients vomiting up food before surgeries even though they had fasted, and patients who were under anesthesia and had food come up during surgery.

          advertisement

          Typically the group reviews extensive literature before issuing formal guidelines, but in this case, there were few studies, he said. “We wanted to just get some guidance out there because so many people had been concerned about the issue.”

          The group’s statement noted there are reports that the gastric emptying effects are reduced with long-term use of the drugs, but Champeau said there isn’t extensive enough data yet to specify how long patients have had to have been on the drug to be at risk.

          “The relationship between how long one has been taking the drug and how much residual gastric content one has, I think, is at this point unpredictable enough that we don’t want to risk the patient’s health,” he said.

          Related: STAT-Harris Poll: Nearly half of U.S. adults would spend $100 a month for Ozempic, other weight loss drugs

          Delayed stomach emptying on GLP-1 drugs may also affect how well patients are able to absorb other oral medications they’re taking. The label for Lilly’s Mounjaro recommends patients taking oral birth control to switch to a non-oral form or add an additional method of birth control for the month after they start taking the drug and after each dose escalation. Studies showed that the drug’s effect on gastric emptying was greatest after the first dose and diminished after subsequent doses, according to the label.

          The anesthesiologist group said that for people undergoing urgent surgeries, doctors should take precautions assuming that the patient has a full stomach.

          For elective procedures, the group recommends that patients who take a daily dose of a GLP-1 drug should hold the treatment the day of surgery, and those who take a weekly dose should hold it the week before surgery.

          The group also said that if the patient is experiencing gastrointestinal symptoms like severe nausea, vomiting or abdominal pain or bloating, that doctors should consider delaying the surgery. Some data suggest that the presence of gastrointestinal side effects are linked to how much food there is in the stomach.

          If the patient has no gastrointestinal symptoms, but the GLP-1 drug was not held, then doctors should consider using an ultrasound to assess what’s in their stomach, the group said. If the stomach is empty, then doctors can proceed as usual, but if the stomach is full or the ultrasound is inconclusive, then doctors should consider delaying the procedure or adding full stomach precautions.

          Anesthesiologists should also discuss the risk of regurgitation and food aspiration with other doctors involved in the surgery and the patient, the group said.

          STAT’s coverage of chronic health issues is supported by a grant from Bloomberg Philanthropies. Our financial supporters are not involved in any decisions about our journalism.

          knowledge

          FDA approval of Sarepta Duchenne genetic therapy gives me hope
          FDA approval of Sarepta Duchenne genetic therapy gives me hope

          Duchennemusculardystrophyhistopathology.Dr.EdwinP.Ewing,Jr./CDCWhenIwasdiagnosedwithDuchennemuscular

          read more
          Maker of FluMist seeks to allow at
          Maker of FluMist seeks to allow at

          ApatientreceivestheFluMistvaccineduringaclinicinSilverSpring,Md.TIMSLOAN/AFP/GettyImagesPeopleeligib

          read more
          Moonlake's readout produced a cash windfall. Risks remain
          Moonlake's readout produced a cash windfall. Risks remain

          MollyFerguson/STATFortwodaysstartingonSunday,MoonlakeImmunotherapeuticshappilycrunchednumbersandshar

          read more

          Telehealth options flood the market as retailers push virtual care

          AdobeWhenpatientsgoshoppingtoday,theymightfindthemselvescheckingoutwithmorethanthevitaminsorbulktoil