<code id='B9BEFD6845'></code><style id='B9BEFD6845'></style>
    • <acronym id='B9BEFD6845'></acronym>
      <center id='B9BEFD6845'><center id='B9BEFD6845'><tfoot id='B9BEFD6845'></tfoot></center><abbr id='B9BEFD6845'><dir id='B9BEFD6845'><tfoot id='B9BEFD6845'></tfoot><noframes id='B9BEFD6845'>

    • <optgroup id='B9BEFD6845'><strike id='B9BEFD6845'><sup id='B9BEFD6845'></sup></strike><code id='B9BEFD6845'></code></optgroup>
        1. <b id='B9BEFD6845'><label id='B9BEFD6845'><select id='B9BEFD6845'><dt id='B9BEFD6845'><span id='B9BEFD6845'></span></dt></select></label></b><u id='B9BEFD6845'></u>
          <i id='B9BEFD6845'><strike id='B9BEFD6845'><tt id='B9BEFD6845'><pre id='B9BEFD6845'></pre></tt></strike></i>

          leisure time

          leisure time

          author:hotspot    Page View:66
          Cyclerion
          David L Ryan/The Boston Globe

          Want to stay on top of the science and politics driving biotech today? Sign up to get our biotech newsletter in your inbox.

          Today, we’ll discuss how the U.S. government is cracking down on Chinese biotechs, and how that might affect the industry stateside. Also, a positive clinical trial for Ironwood Pharmaceuticals still causes a stock slump, and more.

          advertisement

          Scrutiny of Chinese biotechs on the rise

          The federal government and lawmakers have both been ramping up scrutiny of Chinese biotech companies lately. The Biden administration just issued an executive order directing federal health officials to guard against providing contracts and grants to companies, including U.S. firms, that could lead to foreign adversaries getting Americans’ sensitive health data.

          On Capitol Hill, meanwhile, legislation would prohibit the U.S. government from contracting with companies that do business with Chinese “biotechnology companies of concern.”

          Much of the anxiety centers on WuXi, a Chinese company considered a crucial partner for discovering, testing, and making medicines that has worked with biopharma companies including as Pfizer, AstraZeneca, and GSK.

          advertisement

          Read more.

          Are biotech’s dog days over?

          What’s a PIPE? And what can unseat Wegovy? We cover all that and more this week on “The Readout LOUD,” STAT’s biotech podcast.

          We dive into the the latest craze in the world of biotech finance, involving hedge funds and some insider information, and explain why not everyone thinks it’s such a good idea. We also discuss a banner month for biotech stocks and the latest twist in obesity research.

          Listen here.

          FogPharma raises $145 million for helicon therapy

          FogPharma, a Cambridge, Mass., biotech developing treatments for cancer, just closed a $145 million Series E round. The company is designing corkscrew-shaped peptides called helicons that block a signaling pathway called beta-catenin, which is found in many solid tumors. It’s being tested in a Phase 1/2 trial, with data expected later this year.

          CEO Mathai Mammen, former R&D chief at Johnson & Johnson, told STAT that FogPharma is actively looking for ways to couple its helicon therapy with immune-oncology drugs made by other companies.

          Read more.

          Pfizer will focus on antibody drugs

          Pfizer has been struggling with investor dissatisfaction, and is making plans on how to manage the Inflation Reduction Act. The drug giant’s stock dropped 44% last year thanks to a standstill in Covid-related revenue, and the specter looms of many of its key drugs soon going off patent. It said the mix of small molecule drugs in its cancer portfolio will drop from 94% last year to 35% in 2030.

          So now, Pfizer’s oncology unit will focus more intently on protein-based drugs instead of small molecules, which are more vulnerable to generic competition. One Pfizer exec said “this planned shift to biologics is expected to support the accelerated growth in both the top and bottom line.”

          Read more.

          Despite good data, Ironwood’s shares plummet

          Ironwood Pharmaceuticals’ short bowel syndrome drug performed well in a Phase 3 trial, but the company’s shares still tanked 30%, FierceBiotech writes. That’s because the results didn’t convince investors that the medicine would beat out Takeda’s Gattex, which is already on the market, or Zealand Pharma’s glepaglutide.

          Ironwood bought VectaBio last year for $1 billion, acquiring apraglutide, a long-acting GLP-2 analog. It expected the drug to be best-in-class, but the data fell a bit short when looking at secondary endpoints. The company still intends to file for approval of apraglutide.

          More reads

          • Pharma companies ask court not to break up US states’ price-fixing lawsuits, Reuters
          • Novo Nordisk’s new Boston-area campus reflects ‘competitive’ R&D growth, and not just for GLP-1s, Reuters
          • RSV vaccines may be linked to small increased risk of developing Guillain-Barré syndrome, data suggest, STAT
          Pssst. If you’ve made it to the end of this article, you might be interested in joining this secret list for an upcoming biotech newsletter. Just some food for thought.

          explore

          Virginia high school admissions case could be legal follow
          Virginia high school admissions case could be legal follow

          3:24DemonstratorsprotestoutsideoftheSupremeCourtinWashington,Thursday,June29,2023,aftertheSupremeCou

          read more
          Medical experts exlpore how to eliminate bias in clinical algorithms
          Medical experts exlpore how to eliminate bias in clinical algorithms

          AdobeWASHINGTON—Mostofthemedicalcommunityhasacknowledgedthatracismisbakedintomanyofitsclinicaltools:

          read more
          DIEP, the 'gold standard' of breast reconstruction, is under threat
          DIEP, the 'gold standard' of breast reconstruction, is under threat

          AdobeIn1983,Iflewhomefromcollegetobewithmymotherasshewokeupfromamastectomy.Sheoptedoutofbreastrecons

          read more

          Here's how to stay safe from wildfire smoke amid reduced air quality

          1:54ApersonwearingafacemaskwalksnearaviewofthetheEmpireStateBuildingduringheavysmoginNewYorkonJune6,