<code id='C823C351C2'></code><style id='C823C351C2'></style>
    • <acronym id='C823C351C2'></acronym>
      <center id='C823C351C2'><center id='C823C351C2'><tfoot id='C823C351C2'></tfoot></center><abbr id='C823C351C2'><dir id='C823C351C2'><tfoot id='C823C351C2'></tfoot><noframes id='C823C351C2'>

    • <optgroup id='C823C351C2'><strike id='C823C351C2'><sup id='C823C351C2'></sup></strike><code id='C823C351C2'></code></optgroup>
        1. <b id='C823C351C2'><label id='C823C351C2'><select id='C823C351C2'><dt id='C823C351C2'><span id='C823C351C2'></span></dt></select></label></b><u id='C823C351C2'></u>
          <i id='C823C351C2'><strike id='C823C351C2'><tt id='C823C351C2'><pre id='C823C351C2'></pre></tt></strike></i>

          fashion

          fashion

          author:fashion    Page View:1518
          WuXi AppTec company logo on a phone screen against a backgroud showing stock graph — coverage from STAT
          Adobe

          WASHINGTON — The Biotechnology Innovation Organization, an industry trade group, is cutting ties with Chinese company WuXi in response to increasing U.S. government scrutiny of it and other Chinese companies, according to a BIO press release shared with STAT on Wednesday.

          It’s an about-face for a lobbying organization that recently was willing to defend WuXi against attacks, and it’s a sign that the U.S. biotechnology industry will have to make do without a company that it has come to heavily rely on for developing and making drugs.

          advertisement

          WuXi is the only BIO member among the four Chinese companies that would be blacklisted from doing business in the United States by the Biosecure Act, a bipartisan bill that has been introduced in both the House and Senate.

          Get unlimited access to award-winning journalism and exclusive events.

          Subscribe Log In

          explore

          Dobbs anniversary: the lost opportunity of abortion as health care
          Dobbs anniversary: the lost opportunity of abortion as health care

          NathanHoward/GettyImagesReflectingonthisfirstanniversaryoftheSupremeCourt’sdecisioninDobbstooverturn

          read more
          ADCs take center stage as promising cancer treatments
          ADCs take center stage as promising cancer treatments

          AtESMO2023,antibody-drugconjugateswerefeaturedprominently.AndrewJoseph/STATMADRID—Ifyouhadtopinpoint

          read more
          Alkermes shareholders re
          Alkermes shareholders re

          MarkLennihan/APAlkermesshareholdersvotedThursdaytore-electallofthedrugmaker’scurrentdirectors,ending

          read more

          In areas with more Black doctors, Black people live longer

          AdobeBlackpeopleincountieswithmoreBlackprimarycarephysicianslivelonger,accordingtoanewnationalanalys