<code id='CBE1211A68'></code><style id='CBE1211A68'></style>
    • <acronym id='CBE1211A68'></acronym>
      <center id='CBE1211A68'><center id='CBE1211A68'><tfoot id='CBE1211A68'></tfoot></center><abbr id='CBE1211A68'><dir id='CBE1211A68'><tfoot id='CBE1211A68'></tfoot><noframes id='CBE1211A68'>

    • <optgroup id='CBE1211A68'><strike id='CBE1211A68'><sup id='CBE1211A68'></sup></strike><code id='CBE1211A68'></code></optgroup>
        1. <b id='CBE1211A68'><label id='CBE1211A68'><select id='CBE1211A68'><dt id='CBE1211A68'><span id='CBE1211A68'></span></dt></select></label></b><u id='CBE1211A68'></u>
          <i id='CBE1211A68'><strike id='CBE1211A68'><tt id='CBE1211A68'><pre id='CBE1211A68'></pre></tt></strike></i>

          comprehensive

          comprehensive

          author:entertainment    Page View:627
          Astrida Schaeffer
          Since February 2022, Astrida Schaeffer has driven about 160 miles round trip every other week to Brigham and Women’s Hospital in Boston, where researchers are testing an intravenous drug they hope will prevent the onset of Alzheimer’s disease symptoms, or at least delay them. Suzanne Kreiter/The Boston Globe

          Alzheimer’s disease has killed at least three women in Astrida Schaeffer’s family over two generations, leaving her feeling helpless and bereft.

          The first was her Polish-born maternal grandmother, who began showing symptoms when Schaeffer started college in 1981 and died seven years later. Then came her mother, a onetime Fulbright Scholar and high school language teacher who had been fluent in five languages but lost the ability to speak. She died in 2019. Last year, the disease killed Schaeffer’s mother’s sister, a former lab technician for Johnson & Johnson.

          advertisement

          Schaeffer, a 59-year-old costume historian in North Berwick, Maine, has no symptoms of Alzheimer’s. But in 2021 her family history led her to apply to join a clinical trial testing a drug on people at risk for developing them. To participate, volunteers couldn’t have cognitive impairment. But they needed to test positive for a biomarker that put them at higher risk for mental decline ― deposits of a sticky toxic protein in the brain called beta-amyloid that is a hallmark of the disease.

          Get unlimited access to award-winning journalism and exclusive events.

          Subscribe Log In

          comprehensive

          Medicare details structure of new drug price negotiation program
          Medicare details structure of new drug price negotiation program

          MedicareonFridayreleasednewdetailsabouthowitsnewdrugpricenegotiationprogramwillwork,justtwomonthsbef

          read more
          ADA: All diabetes patients should be screened for liver condition
          ADA: All diabetes patients should be screened for liver condition

          HyacinthEmpinado/STATSANDIEGO — TheAmericanDiabetesAssociationsaidSundaythatalladultswithtype2diabet

          read more
          23andMe had bad news about my health. I wish a person had delivered it
          23andMe had bad news about my health. I wish a person had delivered it

          ERICBARADAT/AFP/GettyImagesLastsummer,IthoughtitmightbefuntohavemyDNAanalyzed.Twocompanies,23andMean

          read more

          Here's how to stay safe from wildfire smoke amid reduced air quality

          1:54ApersonwearingafacemaskwalksnearaviewofthetheEmpireStateBuildingduringheavysmoginNewYorkonJune6,