<code id='78C518D763'></code><style id='78C518D763'></style>
    • <acronym id='78C518D763'></acronym>
      <center id='78C518D763'><center id='78C518D763'><tfoot id='78C518D763'></tfoot></center><abbr id='78C518D763'><dir id='78C518D763'><tfoot id='78C518D763'></tfoot><noframes id='78C518D763'>

    • <optgroup id='78C518D763'><strike id='78C518D763'><sup id='78C518D763'></sup></strike><code id='78C518D763'></code></optgroup>
        1. <b id='78C518D763'><label id='78C518D763'><select id='78C518D763'><dt id='78C518D763'><span id='78C518D763'></span></dt></select></label></b><u id='78C518D763'></u>
          <i id='78C518D763'><strike id='78C518D763'><tt id='78C518D763'><pre id='78C518D763'></pre></tt></strike></i>

          Wikipedia

          Wikipedia

          author:entertainment    Page View:6
          3d heart myocarditis
          Adobe

          A drug developed by the biotech firm BridgeBio to treat an increasingly common heart condition succeeded in its main goal in a clinical trial, the company said Monday, and also pointed to potential reductions in hospitalization and death.

          The results may give the medicine, acoramidis, a path to the market after a failure that led its maker’s stock to plunge in December 2021.

          advertisement

          In the time since the initial failure, a rival Pfizer drug has become even more entrenched and another medicine, from Alnylam Pharmaceuticals, has had a successful clinical readout in the heart disease, known as ATTR-CM, in which a defective protein leads clumps to build up in the heart.

          Unlock this article by subscribing to STAT+ and enjoy your first 30 days free!

          GET STARTED Log In

          explore

          How to save PrEP access — and even expand it
          How to save PrEP access — and even expand it

          UndertheAffordableCareAct,healthinsurersarerequiredtocoverallcostsassociatedwithpreventivecare—inclu

          read more
          U.K. agency declines to back Eli Lilly’s Mounjaro for type 2 diabetes
          U.K. agency declines to back Eli Lilly’s Mounjaro for type 2 diabetes

          DarronCummings/APLONDON—AU.K.governmentagencyonTuesdaysaidthatitwon’trecommendEliLilly’sMounjaro—par

          read more
          Hepatitis C has a cure — but many Americans still lack access to it
          Hepatitis C has a cure — but many Americans still lack access to it

          AdobeIn2005,NickVoyleswasdiagnosedwithhepatitisCafterbeingreleasedfromfiveyearsofincarceration.Anurs

          read more

          Here's how to stay safe from wildfire smoke amid reduced air quality

          1:54ApersonwearingafacemaskwalksnearaviewofthetheEmpireStateBuildingduringheavysmoginNewYorkonJune6,