<code id='4D7461E0E9'></code><style id='4D7461E0E9'></style>
    • <acronym id='4D7461E0E9'></acronym>
      <center id='4D7461E0E9'><center id='4D7461E0E9'><tfoot id='4D7461E0E9'></tfoot></center><abbr id='4D7461E0E9'><dir id='4D7461E0E9'><tfoot id='4D7461E0E9'></tfoot><noframes id='4D7461E0E9'>

    • <optgroup id='4D7461E0E9'><strike id='4D7461E0E9'><sup id='4D7461E0E9'></sup></strike><code id='4D7461E0E9'></code></optgroup>
        1. <b id='4D7461E0E9'><label id='4D7461E0E9'><select id='4D7461E0E9'><dt id='4D7461E0E9'><span id='4D7461E0E9'></span></dt></select></label></b><u id='4D7461E0E9'></u>
          <i id='4D7461E0E9'><strike id='4D7461E0E9'><tt id='4D7461E0E9'><pre id='4D7461E0E9'></pre></tt></strike></i>

          explore

          explore

          author:Wikipedia    Page View:57854
          Ruby Wallau for STAT

          Sanofi will license a new CRISPR enzyme from the startup Scribe Therapeutics in a bid to be the first to develop a safer, simpler, and more scalable cure for sickle cell disease.

          The French drugmaker will pay Scribe $40 million upfront and promise another $1.2 billion in potential milestones to license a DNA-cutting enzyme called CasX for use in a potential single-infusion treatment for the serious blood disorder — what’s known as in vivo therapy.CasX was discovered in CRISPR pioneer Jennifer Doudna’s lab, which subsequently spun out Scribe. 

          advertisement

          Scribe was planning to announce the news Tuesday, but it was published early Monday by GEN.  

          Unlock this article by subscribing to STAT+ and enjoy your first 30 days free!

          GET STARTED Log In

          Wikipedia

          Trump demands the U.S. pay no more for drugs than other countries … again
          Trump demands the U.S. pay no more for drugs than other countries … again

          EthanMiller/GettyImagesWASHINGTON—FormerPresidentTrumpisbacktocampaigningfortyingMedicaredrugpricest

          read more
          Telehealth options flood the market as retailers push virtual care
          Telehealth options flood the market as retailers push virtual care

          AdobeWhenpatientsgoshoppingtoday,theymightfindthemselvescheckingoutwithmorethanthevitaminsorbulktoil

          read more
          Malaria cases in Florida and Texas: Here’s what you need to know
          Malaria cases in Florida and Texas: Here’s what you need to know

          MosquitoscaughtfortestingawaitshipmenttoalabinMcAllen,Texas,inApril2016tobetestedformosquito-bornedi

          read more

          WHO may add ‘noma' to its list of neglected tropical diseases

          AchildwithnomasitsonabedinahealthcenterinZinder,Niger.ISSOUFSANOGO/AFPviaGettyImagesIt’sadiseaseofch