<code id='BF1AD09957'></code><style id='BF1AD09957'></style>
    • <acronym id='BF1AD09957'></acronym>
      <center id='BF1AD09957'><center id='BF1AD09957'><tfoot id='BF1AD09957'></tfoot></center><abbr id='BF1AD09957'><dir id='BF1AD09957'><tfoot id='BF1AD09957'></tfoot><noframes id='BF1AD09957'>

    • <optgroup id='BF1AD09957'><strike id='BF1AD09957'><sup id='BF1AD09957'></sup></strike><code id='BF1AD09957'></code></optgroup>
        1. <b id='BF1AD09957'><label id='BF1AD09957'><select id='BF1AD09957'><dt id='BF1AD09957'><span id='BF1AD09957'></span></dt></select></label></b><u id='BF1AD09957'></u>
          <i id='BF1AD09957'><strike id='BF1AD09957'><tt id='BF1AD09957'><pre id='BF1AD09957'></pre></tt></strike></i>

          explore

          explore

          author:comprehensive    Page View:193
          Adam's take main illustration
          Molly Ferguson/STAT

          For two days starting on Sunday, Moonlake Immunotherapeutics happily crunched numbers and shared results from a mid-stage clinical trial that depicted its experimental antibody in the most flattering terms possible.

          The drug, called sonelokimab, was “changing the game” for the treatment of a debilitating skin condition called hidradenitis suppurativa, or HS, said Moonlake CEO Jorge Santos da Silva, on a call for investors and analysts. The drug’s benefit for patients placed it “at the top of the heap,” he added.

          advertisement

          For other, equally important data from the same study that did not fit Moonlake’s home-run narrative, the company took a DIY approach. Curious about how sonelokimab performed against a treatment that’s already approved for HS? Pull out a calculator and do the math yourself. How badly did a higher dose of the drug underperform a lower dose? Take a guess.

          Unlock this article by subscribing to STAT+ and enjoy your first 30 days free!

          GET STARTED Log In

          explore

          Alkermes shareholders re
          Alkermes shareholders re

          MarkLennihan/APAlkermesshareholdersvotedThursdaytore-electallofthedrugmaker’scurrentdirectors,ending

          read more
          In areas with more Black doctors, Black people live longer
          In areas with more Black doctors, Black people live longer

          AdobeBlackpeopleincountieswithmoreBlackprimarycarephysicianslivelonger,accordingtoanewnationalanalys

          read more
          Medical records are filled with copy
          Medical records are filled with copy

          AdobeIrecentlytookcareofapatientwhosemedicalrecordsincludedmultiplenotesaboutherpastopen-heartsurger

          read more

          The science behind Janet Jackson's pregnancy at 49

          JanetJacksonrecentlyannouncedsheispregnantatage49.FrancoisNel/GettyImagesHertourmightbecalledUnstopp