<code id='A9B59ADEDC'></code><style id='A9B59ADEDC'></style>
    • <acronym id='A9B59ADEDC'></acronym>
      <center id='A9B59ADEDC'><center id='A9B59ADEDC'><tfoot id='A9B59ADEDC'></tfoot></center><abbr id='A9B59ADEDC'><dir id='A9B59ADEDC'><tfoot id='A9B59ADEDC'></tfoot><noframes id='A9B59ADEDC'>

    • <optgroup id='A9B59ADEDC'><strike id='A9B59ADEDC'><sup id='A9B59ADEDC'></sup></strike><code id='A9B59ADEDC'></code></optgroup>
        1. <b id='A9B59ADEDC'><label id='A9B59ADEDC'><select id='A9B59ADEDC'><dt id='A9B59ADEDC'><span id='A9B59ADEDC'></span></dt></select></label></b><u id='A9B59ADEDC'></u>
          <i id='A9B59ADEDC'><strike id='A9B59ADEDC'><tt id='A9B59ADEDC'><pre id='A9B59ADEDC'></pre></tt></strike></i>

          focus

          focus

          author:knowledge    Page View:77
          A man enters the Regeneron Clinic at a monoclonal antibody treatment site in Pembroke Pines, Florida – politics and policy coverage from STAT
          Regeneron agreed to price limits for a new Covid-19 drug that will be developed in partnership with the Department of Health and Human Services. CHANDAN KHANNA/AFP via Getty Images

          WASHINGTON — A groundbreaking clause in a new deal between the Department of Health and Human Services and the pharmaceutical company Regeneron marks the first time the Biden administration has directly used its leverage to challenge drugmakers’ list prices, experts told STAT.

          The contract between Regeneron and the government requires that the list price for a future monoclonal antibody drug to prevent Covid-19 is the same or lower in the United States as in other high-income countries. The release doesn’t explain which countries the government will be comparing prices with, or how pricing data will be determined.

          advertisement

          The deal was part of the White House’s Project NextGen initiative, which includes $5 billion in new vaccines and therapies. HHS announced that it is spending $326 million to help Regeneron develop a new monoclonal antibody to prevent Covid-19. Regeneron in January announced plans to start testing a potentially variant-proof antibody, which is set to go into clinical trials later this year.

          Get unlimited access to award-winning journalism and exclusive events.

          Subscribe Log In

          explore

          After affirmative action ruling, medical educators look to 'holistic review'
          After affirmative action ruling, medical educators look to 'holistic review'

          AnnaMoneymaker/GettyImagesAfterhavingadaytoreadthroughtheSupremeCourt’sdecisiononaffirmativeaction,s

          read more
          Cassava Sciences’ Alzheimer’s clinical trials should be halted
          Cassava Sciences’ Alzheimer’s clinical trials should be halted

          MollyFerguson/STATTheFoodandDrugAdministrationshouldhaltCassavaSciences’ongoingclinicaltrialsinAlzhe

          read more
          BioMarin wins approval for gene therapy to treat hemophilia A
          BioMarin wins approval for gene therapy to treat hemophilia A

          AdobeTheFoodandDrugAdministrationonThursdayapprovedagenetherapytotreatpeoplewithhemophiliaA,aninheri

          read more

          In areas with more Black doctors, Black people live longer

          AdobeBlackpeopleincountieswithmoreBlackprimarycarephysicianslivelonger,accordingtoanewnationalanalys