<code id='D492C6112E'></code><style id='D492C6112E'></style>
    • <acronym id='D492C6112E'></acronym>
      <center id='D492C6112E'><center id='D492C6112E'><tfoot id='D492C6112E'></tfoot></center><abbr id='D492C6112E'><dir id='D492C6112E'><tfoot id='D492C6112E'></tfoot><noframes id='D492C6112E'>

    • <optgroup id='D492C6112E'><strike id='D492C6112E'><sup id='D492C6112E'></sup></strike><code id='D492C6112E'></code></optgroup>
        1. <b id='D492C6112E'><label id='D492C6112E'><select id='D492C6112E'><dt id='D492C6112E'><span id='D492C6112E'></span></dt></select></label></b><u id='D492C6112E'></u>
          <i id='D492C6112E'><strike id='D492C6112E'><tt id='D492C6112E'><pre id='D492C6112E'></pre></tt></strike></i>

          knowledge

          knowledge

          author:fashion    Page View:737
          Darron Cummings/AP

          Eli Lilly said Friday it will acquire Versanis Bio, a private company developing an obesity drug that specifically targets fat mass, as the race among pharmaceutical companies to offer weight loss medications intensifies.

          The deal indicates Lilly is aiming to diversify its growing portfolio of weight loss therapies, as Versanis’ drug employs an entirely different mechanism than the existing obesity drugs that Lilly is studying. The pharma giant didn’t say how much it would pay Versanis upfront, but said that if the drug meets certain milestones, the total payment could reach $1.9 billion.

          advertisement

          Lilly, along with other pharma companies like Novo Nordisk, has been developing products in the class of GLP-1 drugs, which mimic the glucagon-like peptide 1 hormone that helps people feel full. These drugs – including Novo’s Ozempic and Wegovy, and Lilly’s Mounjaro – have exploded in popularity because they lead to significant weight loss.

          Unlock this article by subscribing to STAT+ and enjoy your first 30 days free!

          GET STARTED Log In

          explore

          The cancer drug shortage isn’t new — and neither are the solutions
          The cancer drug shortage isn’t new — and neither are the solutions

          PreparingachemotherapytreatmentatDukeCancerCenterinDurham,N.C.GerryBroome/APAyounggirl,maybe5or6year

          read more
          Telehealth options flood the market as retailers push virtual care
          Telehealth options flood the market as retailers push virtual care

          AdobeWhenpatientsgoshoppingtoday,theymightfindthemselvescheckingoutwithmorethanthevitaminsorbulktoil

          read more
          Peter Hotez and the public health issue of online harassment
          Peter Hotez and the public health issue of online harassment

          AdobeFather’sDayweekendwasanythingbutcalmonTwitter,whicheruptedasvaccineexpertPeterHotezwaschallenge

          read more

          Meta's Zuckerberg and Chan on track to put $50 billion into science

          PriscillaChanandMarkZuckerbergonstage,virtually,atthe2023STATSummit.STATMarkZuckerbergandPriscillaCh