<code id='955749E460'></code><style id='955749E460'></style>
    • <acronym id='955749E460'></acronym>
      <center id='955749E460'><center id='955749E460'><tfoot id='955749E460'></tfoot></center><abbr id='955749E460'><dir id='955749E460'><tfoot id='955749E460'></tfoot><noframes id='955749E460'>

    • <optgroup id='955749E460'><strike id='955749E460'><sup id='955749E460'></sup></strike><code id='955749E460'></code></optgroup>
        1. <b id='955749E460'><label id='955749E460'><select id='955749E460'><dt id='955749E460'><span id='955749E460'></span></dt></select></label></b><u id='955749E460'></u>
          <i id='955749E460'><strike id='955749E460'><tt id='955749E460'><pre id='955749E460'></pre></tt></strike></i>

          leisure time

          leisure time

          author:Wikipedia    Page View:36151
          Stain of a biopsy specimen of a rhabdoid tumor -- health coverage from STAT
          Stain of a biopsy specimen of a rhabdoid tumor. Wikimedia Commons

          Most targeted cancer drugs work like tranquilizer darts, snaring an overzealous gene that has spurred the cell into murderously rapid growth.

          But many tumors don’t have a hyperactive gene. Like the mayhem in “Cat in the Hat,” they are enabled by parental absence. They grow because the genes that are meant to provide discipline, guiding the activity of other genes or self-destructing a cell whose DNA is too damaged, are broken or missing.

          advertisement

          These tumors have bedeviled researchers for decades. Restoring or fixing a protein is far harder than breaking it. And that’s bad news for humanity: Cancer is far more likely to be caused by such “tumor-suppressor” genes than by one gene run amok. 

          Get unlimited access to award-winning journalism and exclusive events.

          Subscribe Log In

          focus

          Supreme Court strikes down use of affirmative action
          Supreme Court strikes down use of affirmative action

          ActivistsdemonstratedastheSupremeCourtheardoralargumentsonapairofaffirmativeactioncasesinOctober2022

          read more
          In areas with more Black doctors, Black people live longer
          In areas with more Black doctors, Black people live longer

          AdobeBlackpeopleincountieswithmoreBlackprimarycarephysicianslivelonger,accordingtoanewnationalanalys

          read more
          Virginia high school admissions case could be legal follow
          Virginia high school admissions case could be legal follow

          3:24DemonstratorsprotestoutsideoftheSupremeCourtinWashington,Thursday,June29,2023,aftertheSupremeCou

          read more

          Obesity experts on risks of Wegovy, Ozempic weight loss drugs

          ObesityexpertsJamyArd(left)andRobertLustigspeakatapanelduringthe2023STATBreakthroughSummit.SarahGonz