<code id='1A6318D308'></code><style id='1A6318D308'></style>
    • <acronym id='1A6318D308'></acronym>
      <center id='1A6318D308'><center id='1A6318D308'><tfoot id='1A6318D308'></tfoot></center><abbr id='1A6318D308'><dir id='1A6318D308'><tfoot id='1A6318D308'></tfoot><noframes id='1A6318D308'>

    • <optgroup id='1A6318D308'><strike id='1A6318D308'><sup id='1A6318D308'></sup></strike><code id='1A6318D308'></code></optgroup>
        1. <b id='1A6318D308'><label id='1A6318D308'><select id='1A6318D308'><dt id='1A6318D308'><span id='1A6318D308'></span></dt></select></label></b><u id='1A6318D308'></u>
          <i id='1A6318D308'><strike id='1A6318D308'><tt id='1A6318D308'><pre id='1A6318D308'></pre></tt></strike></i>

          entertainment

          entertainment

          author:explore    Page View:4558
          The New York Stock Exchange (NYSE)
          Spencer Platt/Getty Images

          Biohaven Pharmaceuticals said Wednesday that a new type of experimental medicine reduced levels of a disease-causing immune molecule by up to 37% in an early-stage study of human volunteers — a result that the company called “positive” as a proof of concept but that also fell short of investor expectations.

          The drug, called BHV-1300, belongs to a new class of antibody medicines that shuttle harmful proteins to the liver so they can be removed from the body. BHV-1300 is specifically designed to reduce levels of an autoantibody called IgG that is implicated in rheumatoid arthritis, myasthenia gravis, and other autoimmune disorders.

          advertisement

          In its Phase 1 study, Biohaven tested four escalating doses of BHV-1300 in healthy volunteers, showing a reduction in levels of IgG of 5%, 15%, 30%, and 37%, respectively, the company said. The reductions in IgG levels, which occurred relatively quickly in just four to five days, did not cause significant, adverse changes in liver enzyme levels, Biohaven added — an important safety check given the mechanism of the drug.

          STAT+ Exclusive Story

          Already have an account? Log in

          STAT+

          This article is exclusive to STAT+ subscribers

          Unlock this article — plus daily coverage and analysis of the biotech sector — by subscribing to STAT+.

          Already have an account? Log in

          Already have an account? Log in

          Monthly

          $39

          Totals $468 per year

          $39/month Get Started

          Totals $468 per year

          Starter

          $30

          for 3 months, then $39/month

          $30 for 3 months Get Started

          Then $39/month

          Annual

          $399

          Save 15%

          $399/year Get Started

          Save 15%

          11+ Users

          Custom

          Savings start at 25%!

          Request A Quote Request A Quote

          Savings start at 25%!

          2-10 Users

          $300

          Annually per user

          $300/year Get Started

          $300 Annually per user

          View All Plans

          Get unlimited access to award-winning journalism and exclusive events.

          Subscribe Log In

          explore

          Psychedelics group wrestles with new pharma identity
          Psychedelics group wrestles with new pharma identity

          OliviaGoldhill/STATDENVER—Hecouldhavebeenarockstar,areligiousicon,thewayecstaticapplausefromthousand

          read more
          Supreme Court rules employers must be more accommodating of religious observance
          Supreme Court rules employers must be more accommodating of religious observance

          3:53TheU.S.SupremeCourtisseenonJune23,2023inWashington,D.C.KevinDietsch/GettyImagesAunanimousSupreme

          read more
          The Supreme Court will review a ruling striking down a domestic violence federal gun ban
          The Supreme Court will review a ruling striking down a domestic violence federal gun ban

          WASHINGTON--TheSupremeCourtwillreviewarulingstrikingdownadomesticviolencefederalgunban.

          read more

          Here's how to stay safe from wildfire smoke amid reduced air quality

          1:54ApersonwearingafacemaskwalksnearaviewofthetheEmpireStateBuildingduringheavysmoginNewYorkonJune6,