<code id='B3BF0BC770'></code><style id='B3BF0BC770'></style>
    • <acronym id='B3BF0BC770'></acronym>
      <center id='B3BF0BC770'><center id='B3BF0BC770'><tfoot id='B3BF0BC770'></tfoot></center><abbr id='B3BF0BC770'><dir id='B3BF0BC770'><tfoot id='B3BF0BC770'></tfoot><noframes id='B3BF0BC770'>

    • <optgroup id='B3BF0BC770'><strike id='B3BF0BC770'><sup id='B3BF0BC770'></sup></strike><code id='B3BF0BC770'></code></optgroup>
        1. <b id='B3BF0BC770'><label id='B3BF0BC770'><select id='B3BF0BC770'><dt id='B3BF0BC770'><span id='B3BF0BC770'></span></dt></select></label></b><u id='B3BF0BC770'></u>
          <i id='B3BF0BC770'><strike id='B3BF0BC770'><tt id='B3BF0BC770'><pre id='B3BF0BC770'></pre></tt></strike></i>

          focus

          focus

          author:comprehensive    Page View:6621
          New Sanofi Genzyme president Bill Sibold is the first person without any ties to Henri Termeer (inset) to lead the company. Jonathan Wiggs/Globe staff

          CAMBRIDGE, Mass. — When drug giant Sanofi restructured its global business two years ago, its Genzyme division got a new name, Sanofi Genzyme, explicitly tying it to the French parent company. It also got new responsibilities and a larger “specialty care” portfolio covering everything from enzyme replacement to cancer and multiple sclerosis drugs.

          Last week, Sanofi Genzyme — still the largest Massachusetts biotech, with about 5,000 workers — also got a new president, Bill Sibold. He’s the first one without any ties to the old Genzyme, an independent company that pioneered the rare-disease business model and catalyzed the local life sciences boom before accepting Sanofi’s $20.1 billion takeover offer in 2011.

          Unlock this article by subscribing to STAT+ and enjoy your first 30 days free!

          GET STARTED Log In

          comprehensive

          Food as medicine: CMS rules hamper 'prescribing' of fruits, veggies
          Food as medicine: CMS rules hamper 'prescribing' of fruits, veggies

          AdobeSometimes,anappleadayreallyisjustwhatthedoctorordered.Andforthepastseveralyears,organizationsli

          read more
          In areas with more Black doctors, Black people live longer
          In areas with more Black doctors, Black people live longer

          AdobeBlackpeopleincountieswithmoreBlackprimarycarephysicianslivelonger,accordingtoanewnationalanalys

          read more
          Duchenne breakthrough therapy leaves behind pioneering families
          Duchenne breakthrough therapy leaves behind pioneering families

          DuchennemusculardystrophyDr.EdwinP.Ewing,Jr./CDCPatFurlongwassittinginherhomeofficeinMiddletown,Ohio

          read more

          Weight bias in eating disorder treatment complicated by new weight loss drugs

          ShiraRosenbluthatherhomeinWestHollywood,Calif.AllisonDinnerforSTATThisispartofaseriesaboutnewobesity